PDB entry 3raj

View 3raj on RCSB PDB site
Description: Crystal structure of human CD38 in complex with the Fab fragment of antibody HB7
Class: hydrolase/immune system
Keywords: CD38, ADP-ribosyl cyclase, cyclic ADP-ribose, X-crystallography, Calcium signaling, agonistic antibody, HB7, HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2011-03-28, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.04 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl cyclase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CD38
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28907
      • engineered mutation (56)
      • engineered mutation (120)
      • engineered mutation (165)
      • engineered mutation (175)
    Domains in SCOPe 2.07: d3raja_
  • Chain 'H':
    Compound: heavy chain of the Fab fragment of antibody HB7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RAJ (Start-219)
  • Chain 'L':
    Compound: light chain of the Fab fragment of antibody HB7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RAJ (0-End)
    Domains in SCOPe 2.07: d3rajl1, d3rajl2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rajA (A:)
    efwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcdite
    edyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgef
    dtskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfg
    svevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdk
    flqcvknpedssctsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rajA (A:)
    wsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeedyqpl
    mklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefdtskin
    yqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsvevhn
    lqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniy
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3rajL (L:)
    iqmtqssssfsvslgdrvtitckasediynrlawyqqkpgnaprllisgatsletgvpsr
    fsgsgsgkdytlsitslqtedvatyycqqywstptfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rajL (L:)
    iqmtqssssfsvslgdrvtitckasediynrlawyqqkpgnaprllisgatsletgvpsr
    fsgsgsgkdytlsitslqtedvatyycqqywstptfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfn