PDB entry 3ra8

View 3ra8 on RCSB PDB site
Description: Structural studies of AAV8 capsid transitions associated with endosomal trafficking
Class: Virus
Keywords: Beta Barrel, Viral Capsid, Virus
Deposited on 2011-03-27, released 2011-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.245
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Adeno-associated virus - 8 [TaxId:202813]
    Gene: Adeno Associated Virus
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ra8a_
  • Heterogens: A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ra8A (A:)
    dgvgsssgnwhcdstwlgdrvittstrtwalptynnhlykqisngtsggatndntyfgys
    tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlsfklfniqvkevtqnegtktiannl
    tstiqvftdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycle
    yfpsqmlrtgnnfqftytfedvpfhssyahsqsldrlmnplidqylyylsrtqttggtan
    tqtlgfsqggpntmanqaknwlpgpcyrqqrvstttgqnnnsnfawtagtkyhlngrnsl
    anpgiamathkddeerffpsngilifgkqnaardnadysdvmltseeeikttnpvateey
    givadnlqqqntapqigtvnsqgalpgmvwqnrdvylqgpiwakiphtdgnfhpsplmgg
    fglkhpppqilikntpvpadppttfnqsklnsfitqystgqvsveiewelqkenskrwnp
    eiqytsnyykstsvdfavntegvyseprpigtryltrnl