PDB entry 3r9v

View 3r9v on RCSB PDB site
Description: Cocrystal Structure of Proteolytically Truncated Form of IpaD from Shigella flexneri Bound to Deoxycholate
Class: cell invasion
Keywords: type III secretion system, tip protein, deoxycholate, CELL INVASION
Deposited on 2011-03-26, released 2011-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.229
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invasin ipad
    Species: Shigella flexneri [TaxId:623]
    Gene: ipaD, CP0126
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r9va_
  • Chain 'B':
    Compound: invasin ipad
    Species: Shigella flexneri [TaxId:623]
    Gene: ipaD, CP0126
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r9vb_
  • Heterogens: GOL, DXC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r9vA (A:)
    gshpvssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksaqll
    dilsrneypinkdarellhsapkeaeldgdqmishrelwakiansindineqylkvyeha
    vssytqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplypann
    tvsqeqankwltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldnaky
    qawnagfsaedetmknnlqtlvqkysnansifdnlvkvlsstisss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r9vA (A:)
    eldgdqmishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwispg
    gndgnsvklqvnslkkaleelkekykdkplypanntvsqeqankwltelggtigkvsqkn
    ggyvvsinmtpidnmlksldnlggngevvldnakyqawnagfsaedetmknnlqtlvqky
    snansifdnlvkvlssti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r9vB (B:)
    gshpvssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksaqll
    dilsrneypinkdarellhsapkeaeldgdqmishrelwakiansindineqylkvyeha
    vssytqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplypann
    tvsqeqankwltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldnaky
    qawnagfsaedetmknnlqtlvqkysnansifdnlvkvlsstisss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r9vB (B:)
    gdqmishrelwakiansindineqylkvyehavssytqmyqdfsavlsslkkaleelkek
    ykdkplypanntvsqeqankwltelggtigkvsqknggyvvsinmtpidnmlksldnlgg
    ngevwnagfsaedetmknnlqtlvqkysnansifdnlvkvlss