PDB entry 3r9s

View 3r9s on RCSB PDB site
Description: Structure of a carnitinyl-CoA dehydratase from Mycobacterium avium 104
Class: lyase
Keywords: SSGCID, Seattle Structural Genomics Center for Infectious Disease, carnitinyl-CoA dehydratase, LYASE
Deposited on 2011-03-25, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carnitinyl-CoA dehydratase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r9sa_
  • Chain 'B':
    Compound: Carnitinyl-CoA dehydratase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r9sb_
  • Chain 'C':
    Compound: Carnitinyl-CoA dehydratase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r9sc_
  • Heterogens: BEZ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r9sA (A:)
    gpgsmtdapgalaerrgnvmvitinrpearnavnaavsigvgdaleeaqhdpevravvlt
    gagdksfcagadlkaiarrenlyhpdhpewgfagyvrhfidkptiaavngtalgggtela
    lasdlvvaderaqfglpevkrgliaaaggvfriaeqlprkvamrllltgeplsaaaardw
    glinevveagsvldaalalasaitvnaplsvqaskriaygvddgvvvgdepgwdrtmrem
    rallksedakegprafaekrepvwqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r9sA (A:)
    apgalaerrgnvmvitinrpearnavnaavsigvgdaleeaqhdpevravvltgagdksf
    cagadlkaiarrenlyhpdhpewgfagyvrhfidkptiaavngtalgggtelalasdlvv
    aderaqfglpevkrgliaaaggvfriaeqlprkvamrllltgeplsaaaardwglinevv
    eagsvldaalalasaitvnaplsvqaskriaygvddgvvvgdepgwdrtmremrallkse
    dakegprafaekrepvwqar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r9sB (B:)
    gpgsmtdapgalaerrgnvmvitinrpearnavnaavsigvgdaleeaqhdpevravvlt
    gagdksfcagadlkaiarrenlyhpdhpewgfagyvrhfidkptiaavngtalgggtela
    lasdlvvaderaqfglpevkrgliaaaggvfriaeqlprkvamrllltgeplsaaaardw
    glinevveagsvldaalalasaitvnaplsvqaskriaygvddgvvvgdepgwdrtmrem
    rallksedakegprafaekrepvwqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r9sB (B:)
    apgalaerrgnvmvitinrpearnavnaavsigvgdaleeaqhdpevravvltgagdksf
    cagadlkaenlyhpdhpewgfagyvrhfidkptiaavngtalgggtelalasdlvvader
    aqfglpevkrgliaaaggvfriaeqlprkvamrllltgeplsaaaardwglinevveags
    vldaalalasaitvnaplsvqaskriaygvddgvvvgdepgwdrtmremrallksedake
    gprafaekrepvwqar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r9sC (C:)
    gpgsmtdapgalaerrgnvmvitinrpearnavnaavsigvgdaleeaqhdpevravvlt
    gagdksfcagadlkaiarrenlyhpdhpewgfagyvrhfidkptiaavngtalgggtela
    lasdlvvaderaqfglpevkrgliaaaggvfriaeqlprkvamrllltgeplsaaaardw
    glinevveagsvldaalalasaitvnaplsvqaskriaygvddgvvvgdepgwdrtmrem
    rallksedakegprafaekrepvwqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r9sC (C:)
    apgalaerrgnvmvitinrpearnavnaavsigvgdaleeaqhdpevravvltgagdksf
    cagadlkaiarrenlyhpdhpewgfagyvrhfidkptiaavngtalgggtelalasdlvv
    aderaqfglpevkrgliaaaggvfriaeqlprkvamrllltgeplsaaaardwglinevv
    eagsvldaalalasaitvnaplsvqaskriaygvddgvvvgdepgwdrtmremrallkse
    dakegprafepvwqar