PDB entry 3r9l

View 3r9l on RCSB PDB site
Description: Crystal structure of nucleoside diphosphate kinase from Giardia lamblia featuring a disordered dinucleotide binding site
Class: transferase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, giardiasis, intestinal disease, protozoan parasite, water contaminant, kinase, phosphoryltransfer, ADP, TRANSFERASE
Deposited on 2011-03-25, released 2011-04-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.236
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Giardia lamblia [TaxId:184922]
    Gene: GL50803_11301
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3r9la_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r9lA (A:)
    gpgsmarertflmvkpdgvqrglvgeiisrferrgfklvamkffvpsknlveehykehaa
    rpffaglckflssgpvcamvweganvvsisrtmmgvtkpaesapgtirgdfgidvgrnii
    hgsanlddaareialwfkpeevaswscsleshiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r9lA (A:)
    marertflmvkpdgvqrglvgeiisrferrgfklvamkffssgpvcamvweganvvsisr
    tmmgvtkpaesapgtirgdfgidvgrniihgsanlddaareialwfkpeeva