PDB entry 3r99

View 3r99 on RCSB PDB site
Description: Joint Neutron and X-ray structure of Cytochrome c peroxidase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2011-03-25, released 2012-04-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: NEUT+
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3r99a_
  • Heterogens: HEM, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r99A (A:)
    tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
    ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
    lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
    pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl