PDB entry 3r8q

View 3r8q on RCSB PDB site
Description: Structure of Fibronectin domain 12-14
Class: cell adhesion
Keywords: Fibronectin, heparin, FNIII, heparin binding, CELL ADHESION
Deposited on 2011-03-24, released 2012-04-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibronectin
    Species: Homo sapiens [TaxId:9606]
    Gene: Fibronectin 1, FN, FN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3r8qa1, d3r8qa2, d3r8qa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r8qA (A:)
    mahhhhhhssglevlfqgpaipaptdlkftqvtptslsaqwtppnvqltgyrvrvtpkek
    tgpmkeinlapdsssvvvsglmvatkyevsvyalkdtltsrpaqgvvttlenvspprrar
    vtdatettitiswrtktetitgfqvdavpangqtpiqrtikpdvrsytitglqpgtdyki
    ylytlndnarsspvvidastaidapsnlrflattpnsllvswqppraritgyiikyekpg
    spprevvprprpgvteatitglepgteytiyvialknnqksepligrkkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8qA (A:)
    aipaptdlkftqvtptslsaqwtppnvqltgyrvrvtpkektgpmkeinlapdsssvvvs
    glmvatkyevsvyalkdtltsrpaqgvvttlenvspprrarvtdatettitiswrtktet
    itgfqvdavpangqtpiqrtikpdvrsytitglqpgtdykiylytlndnarsspvvidas
    taidapsnlrflattpnsllvswqppraritgyiikyekpgspprevvprprpgvteati
    tglepgteytiyvialknnqksepligrkkt