PDB entry 3r8b

View 3r8b on RCSB PDB site
Description: Crystal structure of Staphylococcal Enterotoxin B in complex with an affinity matured mouse TCR VBeta8.2 protein, G5-8
Class: toxin/immune system
Keywords: immunoglobulin-like, OB-fold, TOXIN-IMMUNE SYSTEM complex
Deposited on 2011-03-23, released 2011-04-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.247
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3r8ba1, d3r8ba2
  • Chain 'B':
    Compound: g5-8
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R8B
    Domains in SCOPe 2.06: d3r8bb_
  • Chain 'C':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3r8bc1, d3r8bc2
  • Chain 'D':
    Compound: g5-8
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R8B
    Domains in SCOPe 2.06: d3r8bd_
  • Chain 'E':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3r8be1, d3r8be2
  • Chain 'F':
    Compound: g5-8
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R8B
    Domains in SCOPe 2.06: d3r8bf_
  • Chain 'G':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3r8bg1, d3r8bg2
  • Chain 'H':
    Compound: g5-8
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R8B
    Domains in SCOPe 2.06: d3r8bh_
  • Chain 'I':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3r8bi1, d3r8bi2
  • Chain 'J':
    Compound: g5-8
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R8B
    Domains in SCOPe 2.06: d3r8bj_
  • Chain 'K':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3r8bk1, d3r8bk2
  • Chain 'L':
    Compound: g5-8
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R8B
    Domains in SCOPe 2.06: d3r8bl_
  • Chain 'M':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3r8bm1, d3r8bm2
  • Chain 'N':
    Compound: g5-8
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R8B
    Domains in SCOPe 2.06: d3r8bn_
  • Chain 'O':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3r8bo1, d3r8bo2
  • Chain 'P':
    Compound: g5-8
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R8B
    Domains in SCOPe 2.06: d3r8bp_
  • Heterogens: ZN, CL, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r8bA (A:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bA (A:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfskrktcmyggvtehngnqldkyrsit
    vrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfiene
    nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r8bB (B:)
    marleaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnv
    ekgdipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygssr
    vdlqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bB (B:)
    eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd
    ipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r8bC (C:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bC (C:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfskrktcmyggvtehngnqldkyrsit
    vrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfiene
    nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3r8bD (D:)
    marleaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnv
    ekgdipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygssr
    vdlqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bD (D:)
    eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd
    ipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3r8bE (E:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bE (E:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfskrktcmyggvtehngnqldkyrsit
    vrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfiene
    nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3r8bF (F:)
    marleaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnv
    ekgdipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygssr
    vdlqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bF (F:)
    eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd
    ipdgykasrpsqenfslilelatpsqtsvyfcasgggtlyfgagtrlsvlygs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3r8bG (G:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bG (G:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfkrktcmyggvtehngnqldkyrsitv
    rvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfienen
    sfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3r8bH (H:)
    marleaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnv
    ekgdipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygssr
    vdlqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bH (H:)
    eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd
    ipdgykasrpsqenfslilelatpsqtsvyfcasgggtlyfgagtrlsvlygs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3r8bI (I:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bI (I:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfskrktcmyggvtehngnqldkyrsit
    vrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfiene
    nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3r8bJ (J:)
    marleaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnv
    ekgdipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygssr
    vdlqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bJ (J:)
    rleaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvek
    gdipdgykasrpsqenfslilelatpsqtsvyfcasggtlyfgagtrlsvly
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3r8bK (K:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bK (K:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfskrktcmyggvtehngnqldkyrsit
    vrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfiene
    nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3r8bL (L:)
    marleaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnv
    ekgdipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygssr
    vdlqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bL (L:)
    eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd
    ipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3r8bM (M:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bM (M:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfskrktcmyggvtehngnqldkyrsit
    vrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfiene
    nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3r8bN (N:)
    marleaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnv
    ekgdipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygssr
    vdlqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bN (N:)
    eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd
    ipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvly
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3r8bO (O:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bO (O:)
    sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfskrktcmyggvtehngnqldkyrsit
    vrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfiene
    nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3r8bP (P:)
    marleaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnv
    ekgdipdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvlygssr
    vdlqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r8bP (P:)
    eaavtqsprnkvavtgekvtlsckqtnsyfnnmywyrqdtghelrlifmshgirnvekgd
    ipdgykasrpsqenfslilelatpsqtsvyfcasgggtlyfgagtrlsvly