PDB entry 3r87

View 3r87 on RCSB PDB site
Description: Crystal Structure of Orf6 protein from Photobacterium profundum
Class: Unknown Function
Keywords: Unknown Function
Deposited on 2011-03-23, released 2012-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.149
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Photobacterium profundum [TaxId:74109]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r87a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r87A (A:)
    gsmskiyhhpvqiyyedtdhsgvvyhpnflkyferarehvidsdklatlwndhglgfavy
    kanmifqdgvefaeicdirtsftldgkyktlwrqevwrpgasraavigdiemvcldkekr
    lqpvpadilasmmad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r87A (A:)
    mskiyhhpvqiyyedtdhsgvvyhpnflkyferarehvidsdklatlwndhglgfavyka
    nmifqdgvefaeicdirtsftldgkyktlwrqevwrpgasraavigdiemvcldkekrlq
    pvpadilasmma