PDB entry 3r7t

View 3r7t on RCSB PDB site
Description: Crystal Structure of Adenylosuccinate Synthetase from Campylobacter jejuni
Class: ligase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha-beta fold, cytosol, LIGASE
Deposited on 2011-03-23, released 2011-04-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.178
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylosuccinate synthetase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1498c, purA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3r7ta_
  • Heterogens: CIT, PGE, PEG, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r7tA (A:)
    snamskadiivgiqwgdegkgkvvdklcenydfvcrsagghnaghtiwvngvryalhlmp
    sgvlhprciniigngvvvspevliaemaqfenlkgrlyisdrahlnlkhhslidiakekl
    kgknaigttgkgigpsyadkinrtghrvgellepqrlcealikdfeanktffemleieip
    saeelladlkrfneiltpyitdttrmlwkaldedkrvllegaqgsmldidhgtypyvtss
    stisagtltglglnpkeagniigivkayatrvgngafptedkgedgekiaqigkeigvst
    grkrrcgwfdavavrytarlngldalslmkldvldgfekikicrayeykgmeidyipsdl
    envqpiyeemdgwdkvfgikdydllpenakkyiarleelagvkvkyistsperddtiil
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r7tA (A:)
    mskadiivgiqwgdegkgkvvdklcenydfvcrsagghnaghtiwvngvryalhlmpsgv
    lhprciniigngvvvspevliaemaqfenlkgrlyisdrahlnlkhhslidiakeklkgk
    gigpsyadkinrtghrvgellepqrlcealikdfeanktffemleieipsaeelladlkr
    fneiltpyitdttrmlwkaldedkrvllegaqgsmldidhgtypyvtssstisagtltgl
    glnpkeagniigivkayatrvgngafptedkgedgekiaqigkeigvstgrkrrcgwfda
    vavrytarlngldalslmkldvldgfekikicrayeykgmeidyipsdlenvqpiyeemd
    gwdkvfgikdydllpenakkyiarleelagvkvkyistsperddtiil