PDB entry 3r7o

View 3r7o on RCSB PDB site
Description: Structure of dually phosphorylated c-MET receptor kinase in complex with an MK-2461 analog
Class: transferase/transferase inhibitor
Keywords: tyrosine kinase, phosphotyrosine, 1234, 1235, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-03-22, released 2012-02-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (0-300)
      • expression tag (301-304)
    Domains in SCOPe 2.06: d3r7oa1, d3r7oa2
  • Heterogens: M61, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r7oA (A:)
    qntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihc
    avkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrn
    firnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglar
    dmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdv
    ntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfige
    hhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r7oA (A:)
    qntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihc
    avkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrn
    firnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglar
    dmydkeyysvhnklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfd
    itvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehhhh
    h