PDB entry 3r7l

View 3r7l on RCSB PDB site
Description: Crystal Structure of PALA-bound Aspartate Transcarbamoylase from Bacillus subtilis
Class: transferase
Keywords: Aspartate Transcarbamoylase, PALA, Transferase, Catalytic Cycle
Deposited on 2011-03-22, released 2011-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate carbamoyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: pyrB, BSU15490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r7la1, d3r7la2
  • Chain 'B':
    Compound: aspartate carbamoyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: pyrB, BSU15490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r7lb1, d3r7lb2
  • Chain 'C':
    Compound: aspartate carbamoyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: pyrB, BSU15490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r7lc1, d3r7lc2
  • Chain 'D':
    Compound: aspartate carbamoyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: pyrB, BSU15490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r7ld1, d3r7ld2
  • Chain 'E':
    Compound: aspartate carbamoyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: pyrB, BSU15490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r7le1, d3r7le2
  • Chain 'F':
    Compound: aspartate carbamoyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: pyrB, BSU15490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r7lf1, d3r7lf2
  • Heterogens: PAL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r7lA (A:)
    mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
    lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
    gdgcgqhptqslldlmtiyeefntfkgltvsihgdikhsrvarsnaevltrlgarvlfsg
    psewqdeentfgtyvsmdeavessdvvmllriqnerhqsavsqegylnkygltveraerm
    krhaiimhpapvnrgveiddslveseksrifkqmkngvfirmaviqralqtnvkrgeaay
    vish
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r7lA (A:)
    mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
    lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
    gdgcgqhptqslldlmtiyeefntfkgltvsihgdikhsrvarsnaevltrlgarvlfsg
    psewqdeentfgtyvsmdeavessdvvmllriqnerhqsavsqegylnkygltveraerm
    krhaiimhpapvnrgveiddslveseksrifkqmkngvfirmaviqralq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r7lB (B:)
    mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
    lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
    gdgcgqhptqslldlmtiyeefntfkgltvsihgdikhsrvarsnaevltrlgarvlfsg
    psewqdeentfgtyvsmdeavessdvvmllriqnerhqsavsqegylnkygltveraerm
    krhaiimhpapvnrgveiddslveseksrifkqmkngvfirmaviqralqtnvkrgeaay
    vish
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r7lB (B:)
    mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
    lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
    gdgcgqhptqslldlmtiyeefntfkgltvsihgdikhsrvarsnaevltrlgarvlfsg
    psewqdeentfgtyvsmdeavessdvvmllriqnerhqsavsqegylnkygltveraerm
    krhaiimhpapvnrgveiddslveseksrifkqmkngvfirmaviqralq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r7lC (C:)
    mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
    lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
    gdgcgqhptqslldlmtiyeefntfkgltvsihgdikhsrvarsnaevltrlgarvlfsg
    psewqdeentfgtyvsmdeavessdvvmllriqnerhqsavsqegylnkygltveraerm
    krhaiimhpapvnrgveiddslveseksrifkqmkngvfirmaviqralqtnvkrgeaay
    vish
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r7lC (C:)
    mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
    lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
    gdgcgqhptqslldlmtiyeefntfkgltvsihgdikhsrvarsnaevltrlgarvlfsg
    psewqdeentfgtyvsmdeavessdvvmllriqnerhqsavsqegylnkygltveraerm
    krhaiimhpapvnrgveiddslveseksrifkqmkngvfirmaviqralq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3r7lD (D:)
    mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
    lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
    gdgcgqhptqslldlmtiyeefntfkgltvsihgdikhsrvarsnaevltrlgarvlfsg
    psewqdeentfgtyvsmdeavessdvvmllriqnerhqsavsqegylnkygltveraerm
    krhaiimhpapvnrgveiddslveseksrifkqmkngvfirmaviqralqtnvkrgeaay
    vish
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r7lD (D:)
    mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
    lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
    gdgcgqhptqslldlmtiyeefntfkgltvsihgdikhsrvarsnaevltrlgarvlfsg
    psewqdeentfgtyvsmdeavessdvvmllriqnerhqsavsqegylnkygltveraerm
    krhaiimhpapvnrgveiddslveseksrifkqmkngvfirmaviqralq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3r7lE (E:)
    mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
    lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
    gdgcgqhptqslldlmtiyeefntfkgltvsihgdikhsrvarsnaevltrlgarvlfsg
    psewqdeentfgtyvsmdeavessdvvmllriqnerhqsavsqegylnkygltveraerm
    krhaiimhpapvnrgveiddslveseksrifkqmkngvfirmaviqralqtnvkrgeaay
    vish
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r7lE (E:)
    mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
    lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
    gdgcgqhptqslldlmtiyeefntfkgltvsihgdikhsrvarsnaevltrlgarvlfsg
    psewqdeentfgtyvsmdeavessdvvmllriqnerhqsavsqegylnkygltveraerm
    krhaiimhpapvnrgveiddslveseksrifkqmkngvfirmaviqralq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3r7lF (F:)
    mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
    lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
    gdgcgqhptqslldlmtiyeefntfkgltvsihgdikhsrvarsnaevltrlgarvlfsg
    psewqdeentfgtyvsmdeavessdvvmllriqnerhqsavsqegylnkygltveraerm
    krhaiimhpapvnrgveiddslveseksrifkqmkngvfirmaviqralqtnvkrgeaay
    vish
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r7lF (F:)
    mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
    lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
    gdgcgqhptqslldlmtiyeefntfkgltvsihgdikhsrvarsnaevltrlgarvlfsg
    psewqdeentfgtyvsmdeavessdvvmllriqnerhqsavsqegylnkygltveraerm
    krhaiimhpapvnrgveiddslveseksrifkqmkngvfirmaviqralq