PDB entry 3r72

View 3r72 on RCSB PDB site
Description: Apis mellifera odorant binding protein 5
Class: transport protein
Keywords: helical protein, odorant molecules, antennae, TRANSPORT PROTEIN
Deposited on 2011-03-22, released 2012-04-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.153
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Odorant binding protein ASP5
    Species: Apis mellifera [TaxId:7460]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WRW2 (1-121)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d3r72a_
  • Heterogens: NBB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r72A (A:)
    msmsadqveklaknmrksclqkiaiteelvdgmrrgefpddhdlqcyttcimkllrtfkn
    gnfdfdmivkqleitmppeevvigkeivavcrneeytgddcqktyqyvqchykqnpekff
    fp