PDB entry 3r61

View 3r61 on RCSB PDB site
Description: Structure of the MntR Co2+ Complex
Class: transcription regulator
Keywords: Winged helix-turn-helix, Transcription regulator
Deposited on 2011-03-20, released 2012-04-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.216
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis [TaxId:1423]
    Gene: Bacillus subtilis, BSU24520, mntR, yqhN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r61a1, d3r61a2
  • Chain 'B':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis [TaxId:1423]
    Gene: Bacillus subtilis, BSU24520, mntR, yqhN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r61b1, d3r61b2
  • Heterogens: CO, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r61A (A:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r61A (A:)
    psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvltskgkk
    igkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeeddarkk
    dlksiqkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r61B (B:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r61B (B:)
    psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvltskgkk
    igkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeeddarkk
    dlksiqkk