PDB entry 3r60

View 3r60 on RCSB PDB site
Description: Structure of the MntR Fe2+ Complex
Class: transcription regulator
Keywords: Winged helix-turn-helix, Transcription regulator
Deposited on 2011-03-20, released 2012-04-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.241
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis [TaxId:1423]
    Gene: Bacillus subtilis, BSU24520, mntR, yqhN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r60a1, d3r60a2
  • Chain 'B':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis [TaxId:1423]
    Gene: Bacillus subtilis, BSU24520, mntR, yqhN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r60b1, d3r60b2
  • Heterogens: FE2, EPE, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r60A (A:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r60A (A:)
    psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvlt
    skgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeed
    darkkdlksiqkkteh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r60B (B:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r60B (B:)
    psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyeglvltskg
    kkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeeddar
    kkdlksiqkkteh