PDB entry 3r5n

View 3r5n on RCSB PDB site
Description: Crystal structure of PPARgammaLBD complexed with the agonist magnolol
Class: transcription/transcription agonist
Keywords: nuclear receptor, transcription factor, TRANSCRIPTION-TRANSCRIPTION AGONIST complex
Deposited on 2011-03-18, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.26
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r5na_
  • Heterogens: MLO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r5nA (A:)
    lnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkik
    fkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvh
    eiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsd
    laifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlr
    qivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r5nA (A:)
    esadlralakhlydsyiksfpltkakarailtgktkspfviydmnslmmgedkikfskev
    airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
    gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
    pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
    ktslhpllqeiykdly