PDB entry 3r52

View 3r52 on RCSB PDB site
Description: Structure analysis of a wound-inducible lectin ipomoelin from sweet potato
Class: Carbohydrate-binding protein
Keywords: beta prism, Carbohydrate/Sugar Binding, Carbohydrate-binding protein
Deposited on 2011-03-18, released 2012-03-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.188
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ipomoelin
    Species: Ipomoea batatas [TaxId:4120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3r52a_
  • Chain 'B':
    Compound: Ipomoelin
    Species: Ipomoea batatas [TaxId:4120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3r52b_
  • Chain 'C':
    Compound: Ipomoelin
    Species: Ipomoea batatas [TaxId:4120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3r52c_
  • Chain 'D':
    Compound: Ipomoelin
    Species: Ipomoea batatas [TaxId:4120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3r52d_
  • Heterogens: GYP, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r52A (A:)
    hhhhhhmalqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitf
    ssnptdiitvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygp
    yganagtpfnikipdgnkivgffgnsgwyvdaigayytak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r52A (A:)
    lqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitfssnptdii
    tvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygpyganagtp
    fnikipdgnkivgffgnsgwyvdaigayytak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r52B (B:)
    hhhhhhmalqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitf
    ssnptdiitvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygp
    yganagtpfnikipdgnkivgffgnsgwyvdaigayytak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r52B (B:)
    alqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitfssnptdi
    itvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygpyganagt
    pfnikipdgnkivgffgnsgwyvdaigayytak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r52C (C:)
    hhhhhhmalqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitf
    ssnptdiitvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygp
    yganagtpfnikipdgnkivgffgnsgwyvdaigayytak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r52C (C:)
    lqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitfssnptdii
    tvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygpyganagtp
    fnikipdgnkivgffgnsgwyvdaigayytak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3r52D (D:)
    hhhhhhmalqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitf
    ssnptdiitvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygp
    yganagtpfnikipdgnkivgffgnsgwyvdaigayytak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r52D (D:)
    lqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitfssnptdii
    tvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygpyganagtp
    fnikipdgnkivgffgnsgwyvdaigayytak