PDB entry 3r4t

View 3r4t on RCSB PDB site
Description: Crystal structure of 4-aminobutyrate aminotransferase GabT from Mycobacterium marinum covalently bound to pyridoxal phosphate
Class: transferase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Mycobacterium, tuberculosis, smegmatis, marinum, water contaminant, pyridoxal phosphate, PLP, LLP, gamma amino butyric acid, GABA, GABA transferase, Gabaculine, Phenelzine, Aminooxyacetic acid, Phenylethylidenehydrazine, Vigabatrin, Valproic acid, TRANSFERASE
Deposited on 2011-03-17, released 2011-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-aminobutyrate aminotransferase GabT
    Species: Mycobacterium marinum [TaxId:216594]
    Gene: gabT, MMAR_2118
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r4ta_
  • Heterogens: MPD, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r4tA (A:)
    mahhhhhhmgtleaqtqgpgsmvasldqsrllvteipgpaslelnkrraaavsggvgvtl
    pvfvvragggivedadgnrlidlgsgiavttignsaprvvdavrdqveqfthtcfmvtpy
    eqyvavaeqlnritpgsgekrtvlfnsgaeavensikvarahtrkqavvafdyayhgrtn
    ltmaltaksmpyksgfgpfapeiyrapvsypyrdnlldkdiatdgelaaerainlidkqi
    gaanlaaviiepiageggfivpadgflpalqrwcrdndvvfiadevqtgfartgamfacd
    henvepdlivtakgiadgfplsavtgraeimdaphtsglggtfggnpvacaaalatieti
    erdgmverarqierlvmdrllrlqaaddrlgdvrgrgamiamelvksgtaepdaaltqkl
    aaaahaagvivltcgmfgnvirllppltisdellsegldilcqilad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r4tA (A:)
    asldqsrllvteipgpaslelnkrraaavsggvgvtlpvfvvragggivedadgnrlidl
    gsgiavttignsaprvvdavrdqveqfthtcfmvtpyeqyvavaeqlnritpgsgekrtv
    lfnsgaeavensikvarahtrkqavvafdyayhgrtnltmaltaksmpyksgfgpfapei
    yrapvsypyrdnlldkdiatdgelaaerainlidkqigaanlaaviiepiageggfivpa
    dgflpalqrwcrdndvvfiadevqtgfartgamfacdhenvepdlivtakgiadgfplsa
    vtgraeimdaphtsglggtfggnpvacaaalatietierdgmverarqierlvmdrllrl
    qaaddrlgdvrgrgamiamelvksgtaepdaaltqklaaaahaagvivltcgmfgnvirl
    lppltisdellsegldilcqilad