PDB entry 3r4s

View 3r4s on RCSB PDB site
Description: Cell entry of botulinum neurotoxin type C is dependent upon interaction with two ganglioside molecules
Class: hydrolase
Keywords: Botulinum Toxins, gangliosides, Hydrolase
Deposited on 2011-03-17, released 2011-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.17
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type C1
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18640 (6-430)
      • expression tag (3-5)
    Domains in SCOPe 2.06: d3r4sa1, d3r4sa2, d3r4sa3
  • Chain 'B':
    Compound: Botulinum neurotoxin type C1
    Species: Clostridium botulinum [TaxId:1491]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18640 (6-430)
      • expression tag (3-5)
    Domains in SCOPe 2.06: d3r4sb1, d3r4sb2, d3r4sb3
  • Heterogens: SLB, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r4sA (A:)
    mrgsmanindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgk
    vivtqnenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvft
    lkqnedseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltgi
    nfsktitfeinkipdtglitsdsdninmwirdfyifakeldgkdinilfnslqytnvvkd
    ywgndlrynkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikrirgntndt
    rvrggdilyfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindniifqiqp
    mnntyyyasqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgnyasllest
    sthwgfvpvsepgsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r4sA (A:)
    smanindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkviv
    tqnenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkq
    nedseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfs
    ktitfeinkipdtgdsdninmwirdfyifakeldgkdinilfnslqytnvvkdywgndlr
    ynkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikrirgntndtrvrggdi
    lyfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindniifqiqpmnntyyy
    asqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgnyaslleststhwgfv
    pvse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r4sB (B:)
    mrgsmanindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgk
    vivtqnenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvft
    lkqnedseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltgi
    nfsktitfeinkipdtglitsdsdninmwirdfyifakeldgkdinilfnslqytnvvkd
    ywgndlrynkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikrirgntndt
    rvrggdilyfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindniifqiqp
    mnntyyyasqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgnyasllest
    sthwgfvpvsepgsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r4sB (B:)
    smanindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkviv
    tqnenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkq
    nedseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfs
    ktitfeinkipdtgdsdninmwirdfyifakeldgkdinilfnslqytnvvkdywgndlr
    ynkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikrirgntndtrvrggdi
    lyfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindniifqiqpmnntyyy
    asqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgnyaslleststhwgfv
    pvse