PDB entry 3r4l

View 3r4l on RCSB PDB site
Description: Human very long half life Plasminogen Activator Inhibitor type-1
Class: blood clotting
Keywords: serine protease inhibitor, PAI-1, very long half life, plasminogen activator inhibitor type 1, carbohydrate, blood clotting
Deposited on 2011-03-17, released 2011-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasminogen activator inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PAI1, PLANH1, SERPINE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered mutation (173)
      • engineered mutation (331)
    Domains in SCOPe 2.07: d3r4la_
  • Heterogens: NDG, FUC, NAG, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r4lA (A:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngcwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvaqalqkvkievnesctvassstavivsarmapeeiimdrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r4lA (A:)
    hppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaam
    gfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvk
    qvdfseverarfiindwvkthtkgmisnllgkgavdqltrlvlvnalyfngcwktpfpds
    sthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapye
    kevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqf
    qadftslsdqeplhvaqalqkvkievnesctvassstavivsarmapeeiimdrpflfvv
    rhnptgtvlfmgqvmep