PDB entry 3r4c

View 3r4c on RCSB PDB site
Description: Divergence of Structure and Function Among Phosphatases of the Haloalkanoate (HAD) Enzyme Superfamily: Analysis of BT1666 from Bacteroides thetaiotaomicron
Class: hydrolase
Keywords: haloalkanoate dehalogenase enzyme superfamily, phosphohydrolase, HYDROLASE
Deposited on 2011-03-17, released 2011-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.166
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrolase, haloacid dehalogenase-like hydrolase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT1666, BT_1666
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A759 (10-267)
      • expression tag (0-9)
    Domains in SCOPe 2.07: d3r4ca1, d3r4ca2
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r4cA (A:)
    ssglvprgshmikvllldvdgtllsfethkvsqssidalkkvhdsgikiviatgraasdl
    heidavpydgvialngaecvlrdgsvirkvaipaqdfrksmelarefdfavalelnegvf
    vnrltptveqiagivehpvppvvdieemferkeccqlcfyfdeeaeqkvmpllsglsatr
    whplfadvnvagtskatglslfadyyrvkvseimacgdggndipmlkaagigvamgnase
    kvqsvadfvtdtvdnsglykalkhfgvi