PDB entry 3r3r

View 3r3r on RCSB PDB site
Description: Structure of the YrdA ferripyochelin binding protein from Salmonella enterica
Class: transferase
Keywords: Structural Genomics, CSGID, Center for Structural Genomics of Infectious Diseases, all beta protein, single-stranded left-handed beta-helix, TRANSFERASE
Deposited on 2011-03-16, released 2011-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.139
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferripyochelin binding protein
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: yrdA, STM3399
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZLN3 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d3r3ra1, d3r3ra2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r3rA (A:)
    snamsdtlrpyknlfpgigqrvmidtssvvigdvrladdvgiwplvvirgdvnyvaigar
    tniqdgsvlhvthksssnphgnpliigedvtvghkvmlhgctignrvlvgmgsivldgai
    ieddvmigagslvpqhkrlesgylylgspvkqirplsdaersglqysannyvkwkddyls
    qdnhiqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3rA (A:)
    snamsdtlrpyknlfpgigqrvmidtssvvigdvrladdvgiwplvvirgdvnyvaigar
    tniqdgsvlhvthksssnphgnpliigedvtvghkvmlhgctignrvlvgmgsivldgai
    ieddvmigagslvpqhkrlesgylylgspvkqirplsdaersglqysannyvkwkddyls
    qdnh