PDB entry 3r3l

View 3r3l on RCSB PDB site
Description: Structure of NP protein from Lassa AV strain
Class: structural protein
Keywords: nuclear protein, replication, viral protein, structural protein
Deposited on 2011-03-16, released 2011-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.185
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoprotein
    Species: Lassa virus [TaxId:11620]
    Gene: NP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r3la1, d3r3la2
  • Chain 'B':
    Compound: nucleoprotein
    Species: Lassa virus [TaxId:11620]
    Gene: NP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r3lb1, d3r3lb2
  • Chain 'C':
    Compound: nucleoprotein
    Species: Lassa virus [TaxId:11620]
    Gene: NP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r3lc1, d3r3lc2
  • Heterogens: MN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r3lA (A:)
    msaskevksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkqrrd
    dsdlkrlrdlnqavnnlvelkstqqksvlrvgtlssddlltlaadleklkskvtrterpl
    ssgvymgnlssqqldqrrallnligmtngsqgsqagrdgvvrvwdvknaellnnqfgtmp
    sltlacltkqgqvdlndvvqaltdlgliytakypntsdldrltqshpilnmidtkkssln
    isgynfslgaavkagacmldggnmletikvspqsmdgilksilkvkralgmfvsdtpger
    npyenilykiclsgdgwpyiasrtsivgrawentvvdletdgkpqkigsgnsnkslqsag
    fsagltysqlmtlkdamlqldpnaktwmdiegrpedpvevalyqpisgcyihffreptdl
    kqfkqdakyshgidiadlfaaqpgltsaviealprnmvitcqgsedikkllesqgrkdik
    lidialskidsrkfenavwdqykdlchmhtgvvvekkkrggkeeitphcalmdcimfdaa
    vsgglntlvlravlprdmvfrtstprvvldykdhdghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3lA (A:)
    ksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkqrrddsdlkrl
    rdlnqavnnlvelkstqqksvlrvgtlssddlltlaadleklkskvtrterplssgvymg
    nlssqqldqrrallnligmdgvvrvwdvknaellnnqfgtmpsltlacltkqgqvdlndv
    vqaltdlgliytakypntsdldrltqshpilnmidtkksslnisgynfslgaavkagacm
    ldggnmletikvspqsmdgilksilkvkralgmfvsdtpgernpyenilykiclsgdgwp
    yiasrtsivgrawentvvdlgltysqlmtlkdamlqldpnaktwmdiegrpedpvevaly
    qpisgcyihffreptdlkqfkqdakyshgidiadlfaaqpgltsaviealprnmvitcqg
    sedikkllesqgrkdiklidialskidsrkfenavwdqykdlchmhtgvvvekkeeitph
    calmdcimfdaavsgglntlvlravlprdmvfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r3lB (B:)
    msaskevksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkqrrd
    dsdlkrlrdlnqavnnlvelkstqqksvlrvgtlssddlltlaadleklkskvtrterpl
    ssgvymgnlssqqldqrrallnligmtngsqgsqagrdgvvrvwdvknaellnnqfgtmp
    sltlacltkqgqvdlndvvqaltdlgliytakypntsdldrltqshpilnmidtkkssln
    isgynfslgaavkagacmldggnmletikvspqsmdgilksilkvkralgmfvsdtpger
    npyenilykiclsgdgwpyiasrtsivgrawentvvdletdgkpqkigsgnsnkslqsag
    fsagltysqlmtlkdamlqldpnaktwmdiegrpedpvevalyqpisgcyihffreptdl
    kqfkqdakyshgidiadlfaaqpgltsaviealprnmvitcqgsedikkllesqgrkdik
    lidialskidsrkfenavwdqykdlchmhtgvvvekkkrggkeeitphcalmdcimfdaa
    vsgglntlvlravlprdmvfrtstprvvldykdhdghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3lB (B:)
    ksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkqrrddsdlkrl
    rdlnqavnnlvelkstqqksvlrvgtlssddlltlaadleklkskvtrterplssgvymg
    nlssqqldqrrallnligmdgvvrvwdvknaellnnqfgtmpsltlacltkqgqvdlndv
    vqaltdlgliytakypntsdldrltqshpilnmidtkksslnisgynfslgaavkagacm
    ldggnmletikvspqsmdgilksilkvkralgmfvsdtpgernpyenilykiclsgdgwp
    yiasrtsivgrawentvvdlgltysqlmtlkdamlqldpnaktwmdiegrpedpvevaly
    qpisgcyihffreptdlkqfkqdakyshgidiadlfaaqpgltsaviealprnmvitcqg
    sedikkllesqgrkdiklidialskidsrkfenavwdqykdlchmhtgvvvekkkeeitp
    hcalmdcimfdaavsgglntlvlravlprdmvfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r3lC (C:)
    msaskevksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkqrrd
    dsdlkrlrdlnqavnnlvelkstqqksvlrvgtlssddlltlaadleklkskvtrterpl
    ssgvymgnlssqqldqrrallnligmtngsqgsqagrdgvvrvwdvknaellnnqfgtmp
    sltlacltkqgqvdlndvvqaltdlgliytakypntsdldrltqshpilnmidtkkssln
    isgynfslgaavkagacmldggnmletikvspqsmdgilksilkvkralgmfvsdtpger
    npyenilykiclsgdgwpyiasrtsivgrawentvvdletdgkpqkigsgnsnkslqsag
    fsagltysqlmtlkdamlqldpnaktwmdiegrpedpvevalyqpisgcyihffreptdl
    kqfkqdakyshgidiadlfaaqpgltsaviealprnmvitcqgsedikkllesqgrkdik
    lidialskidsrkfenavwdqykdlchmhtgvvvekkkrggkeeitphcalmdcimfdaa
    vsgglntlvlravlprdmvfrtstprvvldykdhdghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3lC (C:)
    ksflwtqslrrelsgycsniklqvvkdaqallhgldfsevsnvqrlmrkqrrddsdlkrl
    rdlnqavnnlvelkstqqksvlrvgtlssddlltlaadleklkskvtrterplssgvymg
    nlssqqldqrrallnligmdgvvrvwdvknaellnnqfgtmpsltlacltkqgqvdlndv
    vqaltdlgliytakypntsdldrltqshpilnmidtkksslnisgynfslgaavkagacm
    ldggnmletikvspqsmdgilksilkvkralgmfvsdtpgernpyenilykiclsgdgwp
    yiasrtsivgrawentvvdlgltysqlmtlkdamlqldpnaktwmdiegrpedpvevaly
    qpisgcyihffreptdlkqfkqdakyshgidiadlfaaqpgltsaviealprnmvitcqg
    sedikkllesqgrkdiklidialskidsrkfenavwdqykdlchmhtgvvvekkeeitph
    calmdcimfdaavsgglvlravlprdmvfr