PDB entry 3r3j

View 3r3j on RCSB PDB site
Description: Kinetic and structural characterization of Plasmodium falciparum glutamate dehydrogenase 2
Class: oxidoreductase
Keywords: Rossman Fold, Oxidoreductase, Apicoplast, Plasmodium falciparum
Deposited on 2011-03-16, released 2012-03-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.231
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0286
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ILF7 (0-455)
      • engineered mutation (106)
    Domains in SCOPe 2.04: d3r3ja1, d3r3ja2
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0286
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ILF7 (0-455)
      • engineered mutation (106)
    Domains in SCOPe 2.04: d3r3jb1, d3r3jb2
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0286
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ILF7 (0-455)
      • engineered mutation (106)
    Domains in SCOPe 2.04: d3r3jc1, d3r3jc2
  • Chain 'D':
    Compound: glutamate dehydrogenase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0286
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ILF7 (0-455)
      • engineered mutation (106)
    Domains in SCOPe 2.04: d3r3jd1, d3r3jd2
  • Chain 'E':
    Compound: glutamate dehydrogenase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0286
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ILF7 (0-455)
      • engineered mutation (106)
    Domains in SCOPe 2.04: d3r3je1, d3r3je2
  • Chain 'F':
    Compound: glutamate dehydrogenase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0286
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ILF7 (0-455)
      • engineered mutation (106)
    Domains in SCOPe 2.04: d3r3jf1, d3r3jf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r3jA (A:)
    lhnygytstksvdnqieelrekvvsknknepeflqafeevlsclkpvfkkdnvyigvlen
    iaeperviqfrvpwindkgehkmnrgfrvqynsvlgpykgglrfhpavnlsvikflgfeq
    ifknslttlpmgggkggsdfdpkgkseneilkfcqsfmtnlfryigpntdvpagdigvgg
    reigylfgqykklknsfegvltgknikwggsniraeatgygvvyfaenvlkdlndnlenk
    kclvsgsgnvaqylvekliekgaivltmsdsngyilepngftkeqlnyimdiknnqrlrl
    keylkysktakyfenqkpwnipcdiafpcatqneinendadlfiqnkckmiveganmpth
    ikalhklkqnniilcpskaanaggvavsglemsqnsmrlqwthqetdmklqnimksiyeq
    chntskiylnesdlvaganiagflkvadsfleqggl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r3jB (B:)
    lhnygytstksvdnqieelrekvvsknknepeflqafeevlsclkpvfkkdnvyigvlen
    iaeperviqfrvpwindkgehkmnrgfrvqynsvlgpykgglrfhpavnlsvikflgfeq
    ifknslttlpmgggkggsdfdpkgkseneilkfcqsfmtnlfryigpntdvpagdigvgg
    reigylfgqykklknsfegvltgknikwggsniraeatgygvvyfaenvlkdlndnlenk
    kclvsgsgnvaqylvekliekgaivltmsdsngyilepngftkeqlnyimdiknnqrlrl
    keylkysktakyfenqkpwnipcdiafpcatqneinendadlfiqnkckmiveganmpth
    ikalhklkqnniilcpskaanaggvavsglemsqnsmrlqwthqetdmklqnimksiyeq
    chntskiylnesdlvaganiagflkvadsfleqggl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r3jC (C:)
    lhnygytstksvdnqieelrekvvsknknepeflqafeevlsclkpvfkkdnvyigvlen
    iaeperviqfrvpwindkgehkmnrgfrvqynsvlgpykgglrfhpavnlsvikflgfeq
    ifknslttlpmgggkggsdfdpkgkseneilkfcqsfmtnlfryigpntdvpagdigvgg
    reigylfgqykklknsfegvltgknikwggsniraeatgygvvyfaenvlkdlndnlenk
    kclvsgsgnvaqylvekliekgaivltmsdsngyilepngftkeqlnyimdiknnqrlrl
    keylkysktakyfenqkpwnipcdiafpcatqneinendadlfiqnkckmiveganmpth
    ikalhklkqnniilcpskaanaggvavsglemsqnsmrlqwthqetdmklqnimksiyeq
    chntskiylnesdlvaganiagflkvadsfleqggl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r3jD (D:)
    lhnygytstksvdnqieelrekvvsknknepeflqafeevlsclkpvfkkdnvyigvlen
    iaeperviqfrvpwindkgehkmnrgfrvqynsvlgpykgglrfhpavnlsvikflgfeq
    ifknslttlpmgggkggsdfdpkgkseneilkfcqsfmtnlfryigpntdvpagdigvgg
    reigylfgqykklknsfegvltgknikwggsniraeatgygvvyfaenvlkdlndnlenk
    kclvsgsgnvaqylvekliekgaivltmsdsngyilepngftkeqlnyimdiknnqrlrl
    keylkysktakyfenqkpwnipcdiafpcatqneinendadlfiqnkckmiveganmpth
    ikalhklkqnniilcpskaanaggvavsglemsqnsmrlqwthqetdmklqnimksiyeq
    chntskiylnesdlvaganiagflkvadsfleqggl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r3jE (E:)
    lhnygytstksvdnqieelrekvvsknknepeflqafeevlsclkpvfkkdnvyigvlen
    iaeperviqfrvpwindkgehkmnrgfrvqynsvlgpykgglrfhpavnlsvikflgfeq
    ifknslttlpmgggkggsdfdpkgkseneilkfcqsfmtnlfryigpntdvpagdigvgg
    reigylfgqykklknsfegvltgknikwggsniraeatgygvvyfaenvlkdlndnlenk
    kclvsgsgnvaqylvekliekgaivltmsdsngyilepngftkeqlnyimdiknnqrlrl
    keylkysktakyfenqkpwnipcdiafpcatqneinendadlfiqnkckmiveganmpth
    ikalhklkqnniilcpskaanaggvavsglemsqnsmrlqwthqetdmklqnimksiyeq
    chntskiylnesdlvaganiagflkvadsfleqggl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r3jF (F:)
    lhnygytstksvdnqieelrekvvsknknepeflqafeevlsclkpvfkkdnvyigvlen
    iaeperviqfrvpwindkgehkmnrgfrvqynsvlgpykgglrfhpavnlsvikflgfeq
    ifknslttlpmgggkggsdfdpkgkseneilkfcqsfmtnlfryigpntdvpagdigvgg
    reigylfgqykklknsfegvltgknikwggsniraeatgygvvyfaenvlkdlndnlenk
    kclvsgsgnvaqylvekliekgaivltmsdsngyilepngftkeqlnyimdiknnqrlrl
    keylkysktakyfenqkpwnipcdiafpcatqneinendadlfiqnkckmiveganmpth
    ikalhklkqnniilcpskaanaggvavsglemsqnsmrlqwthqetdmklqnimksiyeq
    chntskiylnesdlvaganiagflkvadsfleqggl