PDB entry 3r3c

View 3r3c on RCSB PDB site
Description: Crystal structure of Arthrobacter sp. strain SU 4-hydroxybenzoyl CoA thioesterase mutant H64A complexed with 4-hydroxyphenacyl CoA
Class: hydrolase
Keywords: THIOESTERASE, HOTDOG-fold, HYDROLASE, 4-Hydroxybenzoyl-CoA
Deposited on 2011-03-15, released 2012-03-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Arthrobacter sp. [TaxId:1667]
    Gene: fcbC, fcbC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04416 (Start-150)
      • engineered mutation (63)
    Domains in SCOPe 2.06: d3r3ca_
  • Chain 'B':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Arthrobacter sp. [TaxId:1667]
    Gene: fcbC, fcbC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04416 (Start-150)
      • engineered mutation (63)
    Domains in SCOPe 2.06: d3r3cb_
  • Heterogens: 4CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r3cA (A:)
    mhrtsngshatggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrw
    glvaggaycalaemlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihags
    ttwfwdvslrddagrlcavssmsiavrprrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3cA (A:)
    ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrwglvaggaycal
    aemlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd
    dagrlcavssmsiavrprrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r3cB (B:)
    mhrtsngshatggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrw
    glvaggaycalaemlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihags
    ttwfwdvslrddagrlcavssmsiavrprrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r3cB (B:)
    ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrwglvaggaycal
    aemlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd
    dagrlcavssmsiavrprrd