PDB entry 3r37

View 3r37 on RCSB PDB site
Description: Crystal structure of Arthrobacter sp. strain SU 4-hydroxybenzoyl CoA thioesterase mutant E73Q complexed with 4-hydroxyphenacyl CoA
Class: hydrolase
Keywords: THIOESTERASE, HOTDOG-fold, HYDROLASE, 4-Hydroxybenzoyl-CoA
Deposited on 2011-03-15, released 2012-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Arthrobacter sp. [TaxId:1667]
    Gene: fcbC, fcbC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04416 (Start-150)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d3r37a_
  • Chain 'B':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Arthrobacter sp. [TaxId:1667]
    Gene: fcbC, fcbC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04416 (Start-150)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d3r37b_
  • Heterogens: 4CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r37A (A:)
    mhrtsngshatggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrw
    glvhggaycalaqmlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihags
    ttwfwdvslrddagrlcavssmsiavrprrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r37A (A:)
    ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrwglvhggaycal
    aqmlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd
    dagrlcavssmsiavrprrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r37B (B:)
    mhrtsngshatggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrw
    glvhggaycalaqmlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihags
    ttwfwdvslrddagrlcavssmsiavrprrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r37B (B:)
    ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrwglvhggaycal
    aqmlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd
    dagrlcavssmsiavrprrd