PDB entry 3r34

View 3r34 on RCSB PDB site
Description: Crystal structure of Arthrobacter sp. strain SU 4-hydroxybenzoyl CoA thioesterase mutant E73D complexed with CoA
Class: hydrolase
Keywords: THIOESTERASE, HOTDOG-fold, HYDROLASE, 4-Hydroxybenzoyl-CoA
Deposited on 2011-03-15, released 2012-03-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Arthrobacter sp. [TaxId:1667]
    Gene: fcbC, fcbC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04416 (Start-150)
      • engineered mutation (72)
    Domains in SCOPe 2.06: d3r34a_
  • Chain 'B':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Arthrobacter sp. [TaxId:1667]
    Gene: fcbC, fcbC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04416 (Start-150)
      • engineered mutation (72)
    Domains in SCOPe 2.06: d3r34b_
  • Heterogens: COA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r34A (A:)
    mhrtsngshatggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrw
    glvhggaycaladmlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihags
    ttwfwdvslrddagrlcavssmsiavrprrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r34A (A:)
    tggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrwglvhggayca
    ladmlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslr
    ddagrlcavssmsiavrprrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r34B (B:)
    mhrtsngshatggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrw
    glvhggaycaladmlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihags
    ttwfwdvslrddagrlcavssmsiavrprrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r34B (B:)
    ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrwglvhggaycal
    admlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd
    dagrlcavssmsiavrprrd