PDB entry 3r2o

View 3r2o on RCSB PDB site
Description: 1.95 A resolution structure of As-Isolated FtnA from Pseudomonas aeruginosa (pH 6.0)
Class: metal binding protein
Keywords: iron binding, iron storage, iron homeostasis, iron release, iron mobilization, METAL BINDING PROTEIN
Deposited on 2011-03-14, released 2011-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.191
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: bfr, bfrA, PA4235
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3r2oa_
  • Heterogens: NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r2oA (A:)
    mqghpevidylntlltgelaardqyfihsrmyedwgfsklyerlnhemeeetqhadallr
    rilllegtprmrpddihpgttvpemleadlklerhvraalakgialceqhkdfvsrdilk
    aqladteedhaywleqqlgliarmglenylqsqi