PDB entry 3r25

View 3r25 on RCSB PDB site
Description: Crystal structure of enolase superfamily member from Vibrionales bacterium complexed with Mg and Glycerol in the active site
Class: isomerase
Keywords: enolase fold, dehydratase, Mg, acid sugar, ISOMERASE
Deposited on 2011-03-13, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.162
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase / muconate lactonizing enzyme
    Species: Vibrionales bacterium SWAT-3 [TaxId:391574]
    Gene: VSWAT3_13707
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5KUH4 (Start-400)
      • expression tag (2)
    Domains in SCOPe 2.07: d3r25a1, d3r25a2, d3r25a3
  • Chain 'B':
    Compound: Mandelate racemase / muconate lactonizing enzyme
    Species: Vibrionales bacterium SWAT-3 [TaxId:391574]
    Gene: VSWAT3_13707
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5KUH4 (Start-400)
      • expression tag (2)
    Domains in SCOPe 2.07: d3r25b1, d3r25b2, d3r25b3
  • Chain 'C':
    Compound: Mandelate racemase / muconate lactonizing enzyme
    Species: Vibrionales bacterium SWAT-3 [TaxId:391574]
    Gene: VSWAT3_13707
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5KUH4 (Start-400)
      • expression tag (2)
    Domains in SCOPe 2.07: d3r25c1, d3r25c2, d3r25c3
  • Chain 'D':
    Compound: Mandelate racemase / muconate lactonizing enzyme
    Species: Vibrionales bacterium SWAT-3 [TaxId:391574]
    Gene: VSWAT3_13707
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5KUH4 (Start-400)
      • expression tag (2)
    Domains in SCOPe 2.07: d3r25d1, d3r25d2, d3r25d3
  • Chain 'E':
    Compound: Mandelate racemase / muconate lactonizing enzyme
    Species: Vibrionales bacterium SWAT-3 [TaxId:391574]
    Gene: VSWAT3_13707
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5KUH4 (Start-400)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3r25e1, d3r25e2, d3r25e3
  • Chain 'F':
    Compound: Mandelate racemase / muconate lactonizing enzyme
    Species: Vibrionales bacterium SWAT-3 [TaxId:391574]
    Gene: VSWAT3_13707
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5KUH4 (Start-400)
      • expression tag (2)
    Domains in SCOPe 2.07: d3r25f1, d3r25f2, d3r25f3
  • Chain 'G':
    Compound: Mandelate racemase / muconate lactonizing enzyme
    Species: Vibrionales bacterium SWAT-3 [TaxId:391574]
    Gene: VSWAT3_13707
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5KUH4 (Start-400)
      • expression tag (2)
    Domains in SCOPe 2.07: d3r25g1, d3r25g2, d3r25g3
  • Chain 'H':
    Compound: Mandelate racemase / muconate lactonizing enzyme
    Species: Vibrionales bacterium SWAT-3 [TaxId:391574]
    Gene: VSWAT3_13707
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5KUH4 (Start-400)
      • expression tag (2)
    Domains in SCOPe 2.07: d3r25h1, d3r25h2, d3r25h3
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r25A (A:)
    mslketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpi
    ligknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksr
    daipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydq
    dqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnq
    tewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcq
    nfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingyly
    aseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r25A (A:)
    lketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpili
    gknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrda
    ipvythatsdtmegiydlvegflekgykhircqllhttqnptegsyydqdqymdntltmf
    kslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewldnirsqs
    svslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgvriawhcp
    pdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyaseiagigvei
    dreaaaefpvmyrphewtqsrlpdgaihtp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r25B (B:)
    mslketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpi
    ligknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksr
    daipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydq
    dqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnq
    tewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcq
    nfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingyly
    aseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r25B (B:)
    lketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpili
    gknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrda
    ipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydqdq
    ymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqte
    wldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnf
    gvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyas
    eiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r25C (C:)
    mslketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpi
    ligknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksr
    daipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydq
    dqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnq
    tewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcq
    nfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingyly
    aseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r25C (C:)
    lketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpili
    gknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrda
    ipvythatsdtmegiydlvegflekgykhircqllhttqnptegsyydqdqymdntltmf
    kslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewldnirsqs
    svslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgvriawhcp
    pdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyaseiagigvei
    dreaaaefpvmyrphewtqsrlpdgaihtp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3r25D (D:)
    mslketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpi
    ligknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksr
    daipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydq
    dqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnq
    tewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcq
    nfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingyly
    aseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r25D (D:)
    lketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpili
    gknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrda
    ipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydqdq
    ymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqte
    wldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnf
    gvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyas
    eiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3r25E (E:)
    mslketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpi
    ligknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksr
    daipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydq
    dqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnq
    tewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcq
    nfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingyly
    aseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r25E (E:)
    slketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpil
    igknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrd
    aipvythatsdtmegiydlvegflekgykhircqlgfydlhttqnptegsyydqdqymdn
    tltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewldn
    irsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgvri
    awhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyaseiag
    igveidreaaaefpvmyrphewtqsrlpdgaihtp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3r25F (F:)
    mslketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpi
    ligknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksr
    daipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydq
    dqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnq
    tewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcq
    nfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingyly
    aseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r25F (F:)
    lketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpili
    gknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrda
    ipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydqdq
    ymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqte
    wldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnf
    gvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyas
    eiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3r25G (G:)
    mslketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpi
    ligknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksr
    daipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydq
    dqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnq
    tewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcq
    nfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingyly
    aseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r25G (G:)
    lketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpili
    gknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrda
    ipvythatsdtmegiydlvegflekgykhircqlgfytdlhttqnptegsyydqdqymdn
    tltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewldn
    irsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgvri
    awhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyaseiag
    igveidreaaaefpvmyrphewtqsrlpdgaihtp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3r25H (H:)
    mslketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpi
    ligknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksr
    daipvythatsdtmegiydlvegflekgykhircqlgfyggvptdlhttqnptegsyydq
    dqymdntltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnq
    tewldnirsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcq
    nfgvriawhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingyly
    aseiagigveidreaaaefpvmyrphewtqsrlpdgaihtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r25H (H:)
    lketiisdihciitkpdrhnlitvvvetnegvtgfgcatfqqrplavktmvdeylkpili
    gknanniedlwqmmmvnaywrngpvinnaisgvdmalwdikaklagmplhqlfggksrda
    ipvythatsdtmegiydlvegflekgykhircqlgfygglhttqnptegsyydqdqymdn
    tltmfkslrekygnqfhilhdvherlfpnqaiqfakeveqykpyfiedilppnqtewldn
    irsqssvslglgelfnnpeewkslianrridfirchvsqiggitpalklghlcqnfgvri
    awhcppdmtpigaavnthlnvhlhnaaiqehveyngnthkvfpnaaepingylyaseiag
    igveidreaaaefpvmyrphewtqsrlpdgaihtp