PDB entry 3r1n

View 3r1n on RCSB PDB site
Description: MK3 kinase bound to Compound 5b
Class: transferase/transferase inhibitor
Keywords: Kinase domain with bound inhibitor, Kinase domain, phosphotransferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-03-11, released 2011-05-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.216
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3r1na_
  • Heterogens: 05B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r1nA (A:)
    epkkyavtddyqlskqvlglgvngkvlecfhrrtgqkcalkllydspkarqevdhhwqas
    ggphivcildvyenmhhgkrclliimecmeggelfsriqergdqaftereaaeimrdigt
    aiqflhshniahrdvkpenllytskekdavlkltdfgfakettqnalqtpcytpyyvape
    vlgpekydkscdmwslgvimyillcgfppfysntgqaispgmkrrirlgqygfpnpewse
    vsedakqlirlllktdpterltitqfmnhpwinqsmvvpqtplhtarvlqedkdhwdevk
    eemtsalatmrvdydqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r1nA (A:)
    epkkyavtddyqlskqvlglgvngkvlecfhrrtgqkcalkllydspkarqevdhhwqas
    ggphivcildvyenmhhgkrclliimecmeggelfsriqergaftereaaeimrdigtai
    qflhshniahrdvkpenllytskekdavlkltdfgfakettpekydkscdmwslgvimyi
    llcgfppfygfpnpewsevsedakqlirlllktdpterltitqfmnhpwinqsmvvpqtp
    lhtarvlqedkdhwdevkeemtsalatmrvdydq