PDB entry 3r1g

View 3r1g on RCSB PDB site
Description: Structure Basis of Allosteric Inhibition of BACE1 by an Exosite-Binding Antibody
Class: protein binding
Keywords: Aspartal protease, PROTEIN BINDING
Deposited on 2011-03-10, released 2011-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE1, BACE, KIAA1149
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56817 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d3r1gb1, d3r1gb2
  • Chain 'H':
    Compound: FAB of YW412.8.31 antibody heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R1G (0-221)
  • Chain 'L':
    Compound: FAB of YW412.8.31 antibody light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R1G (0-213)
    Domains in SCOPe 2.07: d3r1gl1, d3r1gl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r1gB (B:)
    gsrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyq
    rqlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffings
    nwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggs
    miiggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttn
    lrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtn
    qsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrig
    favsachvhdefrtaavegpfvtldmedcgynipqtdesgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r1gB (B:)
    srgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqr
    qlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsn
    wegilglayaeiarpddslepffdslvkqthvpnlfslqlcgalasvggsmiiggidhsl
    ytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfea
    avksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpq
    qylrpvvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdef
    rtaavegpfvtldmedcgyni
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r1gL (L:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqfptylptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec