PDB entry 3r13

View 3r13 on RCSB PDB site
Description: Crystal structure of a Deoxyribose-phosphate aldolase (TM_1559) from THERMOTOGA MARITIMA at 1.83 A resolution
Class: lyase
Keywords: TIM beta/alpha-barrel, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, LYASE
Deposited on 2011-03-09, released 2011-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribose-phosphate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: deoC, TM1559, TM_1559
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1P5 (12-End)
      • leader sequence (2-11)
    Domains in SCOPe 2.08: d3r13a1, d3r13a2
  • Chain 'B':
    Compound: deoxyribose-phosphate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: deoC, TM1559, TM_1559
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1P5 (12-259)
      • leader sequence (2-11)
    Domains in SCOPe 2.08: d3r13b1, d3r13b2
  • Heterogens: UNL, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r13A (A:)
    mgsdkihhhhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpdd
    ikklclearenrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifa
    vesgadeidmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacv
    isklagahfvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygad
    rigtssgvkivqggeerygg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r13A (A:)
    sdkihhhhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpddik
    klclearenrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifave
    sgadeidmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacvis
    klagahfvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygadri
    gtssgvkivqggeeryg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r13B (B:)
    mgsdkihhhhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpdd
    ikklclearenrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifa
    vesgadeidmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacv
    isklagahfvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygad
    rigtssgvkivqggeerygg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r13B (B:)
    sdkihhhhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpddik
    klclearenrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifave
    sgadeidmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacvis
    klagahfvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygadri
    gtssgvkivqggeerygg