PDB entry 3r12

View 3r12 on RCSB PDB site
Description: Crystal structure of a Deoxyribose-phosphate aldolase (TM_1559) from THERMOTOGA MARITIMA at 1.75 A resolution
Class: lyase
Keywords: tim beta/alpha-barrel, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-biology, lyase
Deposited on 2011-03-09, released 2011-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribose-phosphate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: deoC, TM1559, TM_1559
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1P5 (12-End)
      • leader sequence (4-11)
    Domains in SCOPe 2.07: d3r12a1, d3r12a2
  • Chain 'B':
    Compound: deoxyribose-phosphate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: deoC, TM1559, TM_1559
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1P5 (12-End)
      • leader sequence (4-11)
    Domains in SCOPe 2.07: d3r12b1, d3r12b2
  • Heterogens: CIT, PGO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r12A (A:)
    mgsdkihhhhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpdd
    ikklclearenrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifa
    vesgadeidmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacv
    isklagahfvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygad
    rigtssgvkivqggeerygg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r12A (A:)
    kihhhhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpddikkl
    clearenrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifavesg
    adeidmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacviskl
    agahfvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygadrigt
    ssgvkivqggeeryg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r12B (B:)
    mgsdkihhhhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpdd
    ikklclearenrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifa
    vesgadeidmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacv
    isklagahfvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygad
    rigtssgvkivqggeerygg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r12B (B:)
    kihhhhhhmieyrieeavakyrefyefkpvresagiedvksaiehtnlkpfatpddikkl
    clearenrfhgvcvnpcyvklareelegtdvkvvtvvgfplganetrtkaheaifavesg
    adeidmvinvgmlkakeweyvyedirsvvesvkgkvvkviietcyldteekiaacviskl
    agahfvktstgfgtggataedvhlmkwivgdemgvkasggirtfedavkmimygadrigt
    ssgvkivqggeeryg