PDB entry 3r0y
View 3r0y on RCSB PDB site
Description: Crystal Structures of Multidrug-resistant HIV-1 Protease in Complex with Mechanism-Based Aspartyl Protease Inhibitors
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Hydrolase, Hydrolase-Hydrolase Inhibitor complex
Deposited on
2011-03-09, released
2012-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated
2012-05-23, with a file datestamp of
2012-05-18.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.2
AEROSPACI score: 0.56
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Multidrug-resistant clinical isolate 769 HIV-1 Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot Q000H7 (0-98)
- conflict (24)
- conflict (34-35)
- conflict (45)
Domains in SCOPe 2.06: d3r0ya_ - Chain 'B':
Compound: Multidrug-resistant clinical isolate 769 HIV-1 Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot Q000H7 (0-98)
- conflict (24)
- conflict (34-35)
- conflict (45)
Domains in SCOPe 2.06: d3r0yb_ - Heterogens: RSZ, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3r0yA (A:)
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3r0yB (B:)
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf