PDB entry 3r0s

View 3r0s on RCSB PDB site
Description: UDP-N-acetylglucosamine acyltransferase from Campylobacter jejuni
Class: transferase
Keywords: structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, lipid A biosynthesis, TRANSFERASE
Deposited on 2011-03-08, released 2011-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: Cj0274, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r0sa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r0sA (A:)
    snamkkihpsavieegaqlgddvvieayayvskdakignnvvikqgarilsdttigdhsr
    vfsyaivgdipqdisykeeqksgvvigknatirefatinsgtakgdgftrigdnafimay
    chiahdcllgnniilannatlaghvelgdftvvggltpihqfvkvgegcmiagasalsqd
    ivpfclaegnrasirslnlvgirrrfdkdevdrlsrafktlfrqgdlkenaknllenqes
    envkkmchfiletkrgipvyrgknna
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r0sA (A:)
    kihpsavieegaqlgddvvieayayvskdakignnvvikqgarilsdttigdhsrvfsya
    ivgdipqdisyksgvvigknatirefatinsgtakgdgftrigdnafimaychiahdcll
    gnniilannatlaghvelgdftvvggltpihqfvkvgegcmiagasalsqdivpfclaeg
    nrasirslnlvgirrrfdkdevdrlsrafktlfrqgdlkenaknllenqesenvkkmchf
    iletkrgipvyr