PDB entry 3r0o

View 3r0o on RCSB PDB site
Description: Crystal structure of carnitinyl-CoA hydratase from Mycobacterium avium
Class: lyase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, fatty acid biosynthesis, FAB, coenzyme A, ortholog, LYASE
Deposited on 2011-03-08, released 2011-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carnitinyl-CoA dehydratase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_2597
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r0oa_
  • Chain 'B':
    Compound: Carnitinyl-CoA dehydratase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_2597
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r0ob_
  • Chain 'C':
    Compound: Carnitinyl-CoA dehydratase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_2597
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r0oc_
  • Heterogens: EDO, GOL, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3r0oA (A:)
    gpgsmaetltevtrqaavverrgnvalitidrpdarnavngavstavgdaleeaqrdpev
    wavvitgagdksfcagadlkaisrgenlyhaehpewgfagyvhhfidkptiaavngtalg
    ggselalasdlviacesasfglpevkrgliagaggvfriveqlprkvalelvltgepmta
    sdalrwglinevvpdgtvveaalalaeritcnaplsvqaskrvaygaddgiigaeepkwe
    rtireftellksedakegplafaekrqpvwkar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r0oA (A:)
    vtrqaavverrgnvalitidrpdarnavngavstavgdaleeaqrdpevwavvitgagdk
    sfcagadlkaisrgenlyhaehpewgfagyvhhfidkptiaavngtalgggselalasdl
    viacesasfglpevkrgliagaggvfriveqlprkvalelvltgepmtasdalrwgline
    vvpdgtvveaalalaeritcnaplsvqaskrvaygaddgiigaeepkwertireftellk
    sedakegplafaekrqpvwkar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3r0oB (B:)
    gpgsmaetltevtrqaavverrgnvalitidrpdarnavngavstavgdaleeaqrdpev
    wavvitgagdksfcagadlkaisrgenlyhaehpewgfagyvhhfidkptiaavngtalg
    ggselalasdlviacesasfglpevkrgliagaggvfriveqlprkvalelvltgepmta
    sdalrwglinevvpdgtvveaalalaeritcnaplsvqaskrvaygaddgiigaeepkwe
    rtireftellksedakegplafaekrqpvwkar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r0oB (B:)
    trqaavverrgnvalitidrpdarnavngavstavgdaleeaqrdpevwavvitgagdks
    fcagadlkaisrgenlyhaehpewgfagyvhhfidkptiaavngtalgggselalasdlv
    iacesasfglpevkrgliagaggvfriveqlprkvalelvltgepmtasdalrwglinev
    vpdgtvveaalalaeritcnaplsvqaskrvaygaddgiigaeepkwertireftellks
    edakegplafaekrqpvwkar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3r0oC (C:)
    gpgsmaetltevtrqaavverrgnvalitidrpdarnavngavstavgdaleeaqrdpev
    wavvitgagdksfcagadlkaisrgenlyhaehpewgfagyvhhfidkptiaavngtalg
    ggselalasdlviacesasfglpevkrgliagaggvfriveqlprkvalelvltgepmta
    sdalrwglinevvpdgtvveaalalaeritcnaplsvqaskrvaygaddgiigaeepkwe
    rtireftellksedakegplafaekrqpvwkar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3r0oC (C:)
    vtrqaavverrgnvalitidrpdarnavngavstavgdaleeaqrdpevwavvitgagdk
    sfcagadlkaisrgenlyhaehpewgfagyvhhfidkptiaavngtalgggselalasdl
    viacesasfglpevkrgliagaggvfriveqlprkvalelvltgepmtasdalrwgline
    vvpdgtvveaalalaeritcnaplsvqaskrvaygaddgiigaeepkwertireftellk
    sedakegplafaekrqpvwkar