PDB entry 3r0e

View 3r0e on RCSB PDB site
Description: Structure of Remusatia vivipara lectin
Class: sugar binding protein
Keywords: carbohydrate binding, carbohydrate, SUGAR BINDING PROTEIN
Deposited on 2011-03-07, released 2011-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Remusatia vivipara [TaxId:189456]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5LYJ9 (0-108)
      • conflict (95)
    Domains in SCOPe 2.07: d3r0ea_
  • Chain 'B':
    Compound: lectin
    Species: Remusatia vivipara [TaxId:189456]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r0eb_
  • Chain 'C':
    Compound: lectin
    Species: Remusatia vivipara [TaxId:189456]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5LYJ9 (0-108)
      • conflict (95)
    Domains in SCOPe 2.07: d3r0ec_
  • Chain 'D':
    Compound: lectin
    Species: Remusatia vivipara [TaxId:189456]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3r0ed_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3r0eA (A:)
lgtnyllsgqtldteghlkngdfdlvmqddcnlvlyngnwqsntanngrdckltltdyge
lvikngdgstvwksgaqsvkgnyaavvhpdgrlvvfgpsvfkidpwvrg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3r0eB (B:)
nipftnnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
nhkgeliikdddfktiwssrssskqgeyvlilqddgfgviygpaifetss

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3r0eC (C:)
lgtnyllsgqtldteghlkngdfdlvmqddcnlvlyngnwqsntanngrdckltltdyge
lvikngdgstvwksgaqsvkgnyaavvhpdgrlvvfgpsvfkidpwvrg

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3r0eD (D:)
nipftnnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
nhkgeliikdddfktiwssrssskqgeyvlilqddgfgviygpaifetss