PDB entry 3r06

View 3r06 on RCSB PDB site
Description: Crystal structure of anti-mouse CD3epsilon antibody 2C11 Fab fragment
Class: immune system
Keywords: antibody, anti-CD3epsilon, T-cell receptor, signalling, IMMUNE SYSTEM
Deposited on 2011-03-07, released 2012-01-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-mouse CD3epsilon antibody 2C11 Fab light chain
    Species: Cricetulus migratorius [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R06 (0-212)
    Domains in SCOPe 2.04: d3r06a1, d3r06a2
  • Chain 'B':
    Compound: anti-mouse CD3epsilon antibody 2C11 Fab heavy chain
    Species: Cricetulus migratorius [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R06 (0-215)
  • Chain 'C':
    Compound: anti-mouse CD3epsilon antibody 2C11 Fab light chain
    Species: Cricetulus migratorius [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R06 (0-212)
    Domains in SCOPe 2.04: d3r06c1, d3r06c2
  • Chain 'D':
    Compound: anti-mouse CD3epsilon antibody 2C11 Fab heavy chain
    Species: Cricetulus migratorius [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R06 (0-215)
  • Chain 'E':
    Compound: anti-mouse CD3epsilon antibody 2C11 Fab light chain
    Species: Cricetulus migratorius [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R06 (0-212)
    Domains in SCOPe 2.04: d3r06e1, d3r06e2
  • Chain 'F':
    Compound: anti-mouse CD3epsilon antibody 2C11 Fab heavy chain
    Species: Cricetulus migratorius [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R06 (0-215)
  • Chain 'H':
    Compound: anti-mouse CD3epsilon antibody 2C11 Fab heavy chain
    Species: Cricetulus migratorius [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R06 (0-215)
  • Chain 'L':
    Compound: anti-mouse CD3epsilon antibody 2C11 Fab light chain
    Species: Cricetulus migratorius [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3R06 (0-212)
    Domains in SCOPe 2.04: d3r06l1, d3r06l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r06A (A:)
    diqmtqspsslpaslgdrvtincqasqdisnylnwyqqkpgkapklliyytnkladgvps
    rfsgsgsgrdssftisslesedigsyycqqyynypwtfgpgtkleikradakptvsifpp
    sseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqdskdstyslsstls
    ltkadyerhnlytcevthktstaaivktlnrne
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r06C (C:)
    diqmtqspsslpaslgdrvtincqasqdisnylnwyqqkpgkapklliyytnkladgvps
    rfsgsgsgrdssftisslesedigsyycqqyynypwtfgpgtkleikradakptvsifpp
    sseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqdskdstyslsstls
    ltkadyerhnlytcevthktstaaivktlnrne
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r06E (E:)
    diqmtqspsslpaslgdrvtincqasqdisnylnwyqqkpgkapklliyytnkladgvps
    rfsgsgsgrdssftisslesedigsyycqqyynypwtfgpgtkleikradakptvsifpp
    sseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqdskdstyslsstls
    ltkadyerhnlytcevthktstaaivktlnrne
    

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3r06L (L:)
    diqmtqspsslpaslgdrvtincqasqdisnylnwyqqkpgkapklliyytnkladgvps
    rfsgsgsgrdssftisslesedigsyycqqyynypwtfgpgtkleikradakptvsifpp
    sseqlgtgsatlvcfvnnfypkdinvkwkvdgsekrdgvlqsvtdqdskdstyslsstls
    ltkadyerhnlytcevthktstaaivktlnrne