PDB entry 3qzt

View 3qzt on RCSB PDB site
Description: Crystal Structure of BPTF bromo in complex with histone H4K16ac - Form II
Class: transcription/nuclear protein
Keywords: protein-peptide complex, all alpha helix, transcription, histone h4, nuclear, TRANSCRIPTION-NUCLEAR PROTEIN complex
Deposited on 2011-03-07, released 2011-06-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.166
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleosome-remodeling factor subunit BPTF
    Species: Homo sapiens [TaxId:9606]
    Gene: BPTF, FAC1, FALZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3qzta_
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis, synthetic [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3qztA (A:)
gplgsvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdlatme
ervqrryyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgfka

    Sequence, based on observed residues (ATOM records): (download) 
    >3qztA (A:)
ltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdlatmeervqrr
yyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgfk

  • Chain 'B':
    No sequence available.