PDB entry 3qzk

View 3qzk on RCSB PDB site
Description: Bovine beta-lactoglobulin complex with linoleic acid
Class: transport protein
Keywords: lactoglobulin, linoleic acid, unsaturated fatty acids, lipocalin, transport protein, milk protein
Deposited on 2011-03-06, released 2011-03-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.228
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-lactoglobulin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02754 (0-161)
  Domains in SCOPe 2.01: d3qzka_
• Heterogens: EIC, GOL, EOH, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qzkA (A:)
  livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
  wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
  clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi