PDB entry 3qzj

View 3qzj on RCSB PDB site
Description: Bovine beta-lactoglobulin complex with oleic acid
Class: transport protein
Keywords: lactoglobulin, fatty acid, oleic acid, unsaturated fatty acids, lipocalin, transport, milk protein, TRANSPORT PROTEIN
Deposited on 2011-03-06, released 2011-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.244
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-lactoglobulin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02754 (0-161)
  Domains in SCOPe 2.07: d3qzja_
• Heterogens: OLA, EOH, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qzjA (A:)
  livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
  wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
  clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi