PDB entry 3qzb

View 3qzb on RCSB PDB site
Description: Crystal structure of a putative superoxide reductase (TM0658) from THERMOTOGA MARITIMA at 1.10 A resolution
Class: oxidoreductase
Keywords: immunoglobulin-like beta-sandwich, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-biology, oxidoreductase
Deposited on 2011-03-04, released 2011-03-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.126
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative superoxide reductase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0658, TM_0658
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZC6 (12-142)
      • expression tag (11)
    Domains in SCOPe 2.05: d3qzba_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qzbA (A:)
    mgsdkihhhhhhmklsdfiktedfkkekhvpvieapekvkkdekvqivvtvgkeiphpnt
    tehhirwikvffqpdgdpyvyevgryefnahgesvqgpnigavyteptvttvvklnrsgt
    iialsycnihglwessqkitvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qzbA (A:)
    hmklsdfiktedfkkekhvpvieapekvkkdekvqivvtvgkeiphpnttehhirwikvf
    fqpdgdpyvyevgryefnahgesvqgpnigavyteptvttvvklnrsgtiialsycnihg
    lwessqkitvee