PDB entry 3qz5

View 3qz5 on RCSB PDB site
Description: Crystal Structure of Co-type Nitrile Hydratase alpha-E168Q from Pseudomonas putida.
Class: lyase
Keywords: nitrile hydratase, CO, Cobalt, Cysteine Sulfinic Acid, LYASE
Deposited on 2011-03-04, released 2011-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Co-type Nitrile Hydratase alpha subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QZ5
    Domains in SCOPe 2.07: d3qz5a_
  • Chain 'B':
    Compound: Co-type Nitrile Hydratase beta subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QZ5 (0-218)
    Domains in SCOPe 2.07: d3qz5b_
  • Chain 'C':
    Compound: Co-type Nitrile Hydratase alpha subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QZ5
    Domains in SCOPe 2.07: d3qz5c_
  • Chain 'D':
    Compound: Co-type Nitrile Hydratase beta subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QZ5 (0-218)
    Domains in SCOPe 2.07: d3qz5d_
  • Chain 'E':
    Compound: Co-type Nitrile Hydratase alpha subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QZ5
    Domains in SCOPe 2.07: d3qz5e_
  • Chain 'F':
    Compound: Co-type Nitrile Hydratase beta subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QZ5 (0-218)
    Domains in SCOPe 2.07: d3qz5f_
  • Chain 'G':
    Compound: Co-type Nitrile Hydratase alpha subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QZ5
    Domains in SCOPe 2.07: d3qz5g_
  • Chain 'H':
    Compound: Co-type Nitrile Hydratase beta subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QZ5 (0-218)
    Domains in SCOPe 2.07: d3qz5h_
  • Heterogens: GOL, 3CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qz5A (A:)
    mgqshthdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprnga
    kvvakawvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypw
    ptlglppawykaapyrsrmvsdprgvlaefglvipankeirvwdttaqlrymvlperpag
    teayseeqlaelvtrdsmigtglptqptpsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qz5A (A:)
    hdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvaka
    wvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglp
    pawykaapyrsrmvsdprgvlaefglvipankeirvwdttaqlrymvlperpagteayse
    eqlaelvtrdsmigtglptqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qz5B (B:)
    mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
    ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
    aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
    hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qz5C (C:)
    mgqshthdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprnga
    kvvakawvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypw
    ptlglppawykaapyrsrmvsdprgvlaefglvipankeirvwdttaqlrymvlperpag
    teayseeqlaelvtrdsmigtglptqptpsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qz5C (C:)
    hdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvaka
    wvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglp
    pawykaapyrsrmvsdprgvlaefglvipankeirvwdttaqlrymvlperpagteayse
    eqlaelvtrdsmigtglptqp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qz5D (D:)
    mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
    ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
    aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
    hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3qz5E (E:)
    mgqshthdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprnga
    kvvakawvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypw
    ptlglppawykaapyrsrmvsdprgvlaefglvipankeirvwdttaqlrymvlperpag
    teayseeqlaelvtrdsmigtglptqptpsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qz5E (E:)
    dhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvakaw
    vdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglpp
    awykaapyrsrmvsdprgvlaefglvipankeirvwdttaqlrymvlperpagteaysee
    qlaelvtrdsmigtglptqp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qz5F (F:)
    mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
    ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
    aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
    hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3qz5G (G:)
    mgqshthdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprnga
    kvvakawvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypw
    ptlglppawykaapyrsrmvsdprgvlaefglvipankeirvwdttaqlrymvlperpag
    teayseeqlaelvtrdsmigtglptqptpsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qz5G (G:)
    dhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvakaw
    vdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglpp
    awykaapyrsrmvsdprgvlaefglvipankeirvwdttaqlrymvlperpagteaysee
    qlaelvtrdsmigtglptqp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qz5H (H:)
    mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
    ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
    aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
    hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa