PDB entry 3qz3

View 3qz3 on RCSB PDB site
Description: The crystal structure of ferritin from Vibrio cholerae O1 biovar El Tor str. N16961
Class: oxidoreductase
Keywords: structural genomics, The Center for Structural Genomics of Infectious Diseases, CSGID, all alpha ferritin-like, cytoplasmic, OXIDOREDUCTASE
Deposited on 2011-03-04, released 2011-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_0078
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qz3a_
  • Chain 'B':
    Compound: Ferritin
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_0078
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qz3b_
  • Chain 'C':
    Compound: Ferritin
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VC_0078
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qz3c_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qz3A (A:)
    snamnqeffmlsqamvehlneqinleffssnlylqmsawcedkgfdgaaeflrahaveem
    qhmqrlftyvsetgalpilgaiaaprhdfaslgevfretyqheqkitqqinklahvafts
    qdystfnflqwyvaeqheeeklfkgildklelvgedgkalffidkdlaalakkgsssvmd
    apae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qz3A (A:)
    fmlsqamvehlneqinleffssnlylqmsawcedkgfdgaaeflrahaveemqhmqrlft
    yvsetgalpilgaiaaprhdfaslgevfretyqheqkitqqinklahvaftsqdystfnf
    lqwyvaeqheeeklfkgildklelvgedgkalffidkdlaalakk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qz3B (B:)
    snamnqeffmlsqamvehlneqinleffssnlylqmsawcedkgfdgaaeflrahaveem
    qhmqrlftyvsetgalpilgaiaaprhdfaslgevfretyqheqkitqqinklahvafts
    qdystfnflqwyvaeqheeeklfkgildklelvgedgkalffidkdlaalakkgsssvmd
    apae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qz3B (B:)
    mlsqamvehlneqinleffssnlylqmsawcedkgfdgaaeflrahaveemqhmqrlfty
    vsetgalpilgaiaaprhdfaslgevfretyqheqkitqqinklahvaftsqdystfnfl
    qwyvaeqheeeklfkgildklelvgedgkalffidkdlaalak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qz3C (C:)
    snamnqeffmlsqamvehlneqinleffssnlylqmsawcedkgfdgaaeflrahaveem
    qhmqrlftyvsetgalpilgaiaaprhdfaslgevfretyqheqkitqqinklahvafts
    qdystfnflqwyvaeqheeeklfkgildklelvgedgkalffidkdlaalakkgsssvmd
    apae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qz3C (C:)
    mlsqamvehlneqinleffssnlylqmsawcedkgfdgaaeflrahaveemqhmqrlfty
    vsetgalpilgaiaaprhdfaslgevfretyqheqkitqqinklahvaftsqdystfnfl
    qwyvaeqheeeklfkgildklelvgedgkalffidkdlaalakk