PDB entry 3qy4

View 3qy4 on RCSB PDB site
Description: Crystallization and in situ data collection of Lysozyme using the Crystal Former
Class: hydrolase
Keywords: hydrolase
Deposited on 2011-03-02, released 2011-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.175
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • conflict (72)
      • conflict (128)
    Domains in SCOPe 2.07: d3qy4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qy4A (A:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgrtpgssnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcra