PDB entry 3qy3

View 3qy3 on RCSB PDB site
Description: PA2801 protein, a putative Thioesterase from Pseudomonas aeruginosa
Class: hydrolase
Keywords: structural genomics, psi, protein structure initiative, midwest center for structural genomics, mcsg, hydrolase
Deposited on 2011-03-02, released 2011-03-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioesterase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA2801
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3qy3a1
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qy3A (A:)
    mgsshhhhhhssgrenlyfqghmadrqllhtahipvrwgdmdsyghvnntlyfqyleear
    vawfetlgidlegaaegpvvlqslhtylkpvvhpatvvvelyagrlgtsslvlehrlhtl
    edpqgtygeghcklvwvrhaenrstpvpdsiraaiags
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qy3A (A:)
    qllhtahipvrwgdmdsyghvnntlyfqyleearvawfetlgidlegaaegpvvlqslht
    ylkpvvhpatvvvelyagrlgtsslvlehrlhtledpqgtygeghcklvwvrhaenrstp
    vpdsiraaia