PDB entry 3qy2

View 3qy2 on RCSB PDB site
Description: Crystal structure of the P93A monomer mutant of S. cerevisiae Cks1
Class: transferase regulator
Keywords: protein kinase activator, ubiquitin binding, transcription, Cdc28 kinase, cell cycle, cyclin-dependent kinase, TRANSFERASE REGULATOR
Deposited on 2011-03-02, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.217
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinases regulatory subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CKS1, YBR135W, YBR1011
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20486 (0-End)
      • engineered mutation (92)
    Domains in SCOPe 2.07: d3qy2a_
  • Chain 'B':
    Compound: cyclin-dependent kinases regulatory subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CKS1, YBR135W, YBR1011
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20486
      • engineered mutation (92)
    Domains in SCOPe 2.07: d3qy2b_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3qy2A (A:)
myhhyhafqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfn
sevgtlriltedewrglgitqslgwehyechaaephillfkrplnyeaelraataaa

    Sequence, based on observed residues (ATOM records): (download) 
    >3qy2A (A:)
myhhyhafqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfn
sevgtlriltedewrglgitqslgwehyechaaephillfkrpln

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3qy2B (B:)
myhhyhafqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfn
sevgtlriltedewrglgitqslgwehyechaaephillfkrplnyeaelraataaa

    Sequence, based on observed residues (ATOM records): (download) 
    >3qy2B (B:)
afqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgtl
riltedewrglgitqslgwehyechaaephillfkrplnyeaelr