PDB entry 3qxw

View 3qxw on RCSB PDB site
Description: Free structure of an anti-methotrexate CDR1-4 Graft VHH Antibody
Class: immune system
Keywords: Camelid Single Domain Antibody, Heavy Chain Only, VHH, Antibody, Anti-Hapten Antibody, CDR, Hapten Binding, Small Molecule Sensing, Ligand Binding, Low Molecular Weight Compound, Methotrexate, IMMUNE SYSTEM
Deposited on 2011-03-02, released 2011-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-Methotrexate CDR1-4 Graft VHH
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXW (Start-125)
    Domains in SCOPe 2.07: d3qxwa_
  • Chain 'B':
    Compound: Anti-Methotrexate CDR1-4 Graft VHH
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXW (Start-125)
    Domains in SCOPe 2.07: d3qxwb_
  • Chain 'C':
    Compound: Anti-Methotrexate CDR1-4 Graft VHH
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXW (Start-125)
    Domains in SCOPe 2.07: d3qxwc_
  • Chain 'D':
    Compound: Anti-Methotrexate CDR1-4 Graft VHH
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXW (Start-125)
    Domains in SCOPe 2.07: d3qxwd_
  • Chain 'E':
    Compound: Anti-Methotrexate CDR1-4 Graft VHH
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXW (Start-125)
    Domains in SCOPe 2.07: d3qxwe_
  • Heterogens: NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qxwA (A:)
    gsqvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlt
    tygdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgt
    qvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxwA (A:)
    qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
    gdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
    tvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qxwB (B:)
    gsqvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlt
    tygdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgt
    qvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxwB (B:)
    qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
    gdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
    tvss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qxwC (C:)
    gsqvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlt
    tygdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgt
    qvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxwC (C:)
    vqlvesggglvqaggslrlscaasrswamawfrqapgkerefvakisgdgrlttygdsvk
    grftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qxwD (D:)
    gsqvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlt
    tygdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgt
    qvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxwD (D:)
    vqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlttyg
    dsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqvt
    vss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3qxwE (E:)
    gsqvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlt
    tygdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgt
    qvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxwE (E:)
    qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
    gdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
    tvss