PDB entry 3qxv

View 3qxv on RCSB PDB site
Description: Structure of an Anti-Methotrexate CDR1-4 Graft VHH Antibody in Complex with Methotrexate
Class: immune system
Keywords: Camelid Single Domain Antibody, Heavy Chain Only, VHH, Antibody, Anti-Hapten Antibody, CDR,Hapten Binding, Small Molecule Sensing, Ligand Binding, Low Molecular Weight Compound, Methotrexate, IMMUNE SYSTEM
Deposited on 2011-03-02, released 2011-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.232
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-Methotrexate CDR1-4 Graft VHH
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXV (Start-125)
    Domains in SCOPe 2.07: d3qxva_
  • Chain 'B':
    Compound: Anti-Methotrexate CDR1-4 Graft VHH
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXV (Start-125)
    Domains in SCOPe 2.07: d3qxvb_
  • Chain 'C':
    Compound: Anti-Methotrexate CDR1-4 Graft VHH
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXV (Start-125)
    Domains in SCOPe 2.07: d3qxvc_
  • Chain 'D':
    Compound: Anti-Methotrexate CDR1-4 Graft VHH
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXV (Start-125)
    Domains in SCOPe 2.07: d3qxvd_
  • Chain 'E':
    Compound: Anti-Methotrexate CDR1-4 Graft VHH
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QXV
    Domains in SCOPe 2.07: d3qxve_
  • Heterogens: MTX, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qxvA (A:)
    gsqvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlt
    tygdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgt
    qvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxvA (A:)
    vqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlttyg
    dsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqvt
    vss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qxvB (B:)
    gsqvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlt
    tygdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgt
    qvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxvB (B:)
    vqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlttyg
    dsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqvt
    vss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qxvC (C:)
    gsqvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlt
    tygdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgt
    qvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxvC (C:)
    vqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlttyg
    dsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqvt
    vss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qxvD (D:)
    gsqvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlt
    tygdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgt
    qvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxvD (D:)
    qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
    gdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
    tvss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3qxvE (E:)
    gsqvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrlt
    tygdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgt
    qvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxvE (E:)
    vqlvesgqaggslrlscaasrrssrswamawfrakerefvakisgdgrlttygdsvkgrf
    tisrdnaeylvylqmdlkpedtavyycaaddnyvtaswrsgpdywgqgtqvtv