PDB entry 3qxg

View 3qxg on RCSB PDB site
Description: Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron complexed with calcium, a closed cap conformation
Class: hydrolase
Keywords: HYDROLASE, PYROPHOSPHATASE, MAGNESIUM BINDING SITE, NEW YORK SGX RESEARCH CENTER FOR STRUCTURAL GENOMICS, ENZYME FUNCTION INITIATIVE, EFI, PSI-2, Protein Structure Initiative, NYSGXRC
Deposited on 2011-03-01, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.153
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2127
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qxga_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2127
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qxgb_
  • Heterogens: ACT, CA, PO4, TLA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qxgA (A:)
    gsshhhhhhssglvprgshmrkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsre
    eaymhegrtgastinivfqrelgkeatqeeiesiyheksilfnsypeaermpgawellqk
    vksegltpmvvtgsgqlsllerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgg
    lkadeavvienaplgveaghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdt
    iml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxgA (A:)
    kklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfqre
    lgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlslle
    rlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveaghk
    agiftiavntgpldgqvlldagadllfpsmqtlcdswdtiml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qxgB (B:)
    gsshhhhhhssglvprgshmrkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsre
    eaymhegrtgastinivfqrelgkeatqeeiesiyheksilfnsypeaermpgawellqk
    vksegltpmvvtgsgqlsllerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgg
    lkadeavvienaplgveaghkagiftiavntgpldgqvlldagadllfpsmqtlcdswdt
    iml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qxgB (B:)
    rkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhegrtgastinivfqr
    elgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsll
    erlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveagh
    kagiftiavntgpldgqvlldagadllfpsmqtlcdswdtiml